🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CMC1

DescripciónCOX assembly mitochondrial protein homolog

Gene and Protein Information

Gene ID152100
Uniprot Accession IDs Q7Z7K0 Q68DJ7 Cmc1p
Ensembl ID ENSP00000418348
Symbol C3orf68 C3orf68
FamilyBelongs to the CMC family.
Sequence
MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp460238CMC1C-X9-C motif containing 19598VGNC:9667OMA, EggNOG
Mouse67899Cmc1COX assembly mitochondrial protein 110090MGI:1915149Inparanoid, OMA, EggNOG
Rat363162Cmc1C-x(9)-C motif containing 110116RGD:1305283Inparanoid, OMA, EggNOG
Dog485633CMC1C-X9-C motif containing 19615VGNC:39377Inparanoid, OMA, EggNOG
HorseCMC1C-X9-C motif containing 1 [Source:HGNC Symbol;Acc:HGNC:28783]9796OMA, EggNOG
Cow767824CMC1C-X9-C motif containing 19913VGNC:27478Inparanoid, OMA, EggNOG
Opossum100031844CMC1C-X9-C motif containing 113616Inparanoid, OMA, EggNOG
Chicken420659CMC1C-X9-C motif containing 19031CGNC:51311Inparanoid, OMA
Anole lizard100567181cmc1C-X9-C motif containing 128377Inparanoid, OMA, EggNOG
Xenopus100135408cmc1C-x(9)-C motif containing 18364XB-GENE-971040Inparanoid, OMA, EggNOG
Zebrafish406630cmc1C-x(9)-C motif containing 17955ZDB-GENE-040426-2626Inparanoid, OMA
Fruitfly34998CG17996CG17996 gene product from transcript CG17996-RA7227FBgn0032595Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.