🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

MDH1

DescripciónMalate dehydrogenase, cytoplasmic

Gene and Protein Information

Gene ID4190
Uniprot Accession IDs P40925 B2R5V5 B4DUN2 B7Z3I7 F5H098 Q6I9V0
Ensembl ID ENSP00000438144
Symbol MDHA MDHA MOR2 MDH-s HEL-S-32 MGC:1375
FamilyBelongs to the LDH/MDH superfamily. MDH type 2 family.
Sequence
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp459271MDH1malate dehydrogenase 19598VGNC:2925OMA, EggNOG
Macaque694703MDH1malate dehydrogenase 19544Inparanoid, OMA, EggNOG
Mouse17449Mdh1malate dehydrogenase 1, NAD (soluble)10090MGI:97051Inparanoid, OMA, EggNOG
Rat24551Mdh1malate dehydrogenase 110116RGD:3072Inparanoid, OMA, EggNOG
Dog474614MDH1malate dehydrogenase 19615VGNC:43103Inparanoid, OMA, EggNOG
Horse100051612MDH1malate dehydrogenase 19796VGNC:20056Inparanoid, OMA, EggNOG
Cow535182MDH1malate dehydrogenase 19913VGNC:31333Inparanoid, OMA, EggNOG
Opossum100031872MDH1malate dehydrogenase 113616Inparanoid, EggNOG
Platypus100082315MDH1malate dehydrogenase 19258Inparanoid, OMA, EggNOG
Chicken421281MDH1malate dehydrogenase 19031CGNC:6725Inparanoid, OMA, EggNOG
Anole lizard100553622mdh1malate dehydrogenase 128377Inparanoid, OMA, EggNOG
Xenopus448318mdh1malate dehydrogenase 18364XB-GENE-484872Inparanoid, OMA, EggNOG
Zebrafish399662mdh1aamalate dehydrogenase 1Aa, NAD (soluble)7955ZDB-GENE-040204-1OMA, EggNOG
Fruitfly34414Mdh1Malate dehydrogenase 17227FBgn0262782Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    Malate dehydrogenase, cytoplasmic
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Dehydrogenase    /    Malate dehydrogenase, cytoplasmic

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.