🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

MAP1LC3A

DescripciónMicrotubule-associated proteins 1A/1B light chain 3A

Gene and Protein Information

Gene ID84557
Uniprot Accession IDs Q9H492 E1P5P4 E1P5P5 Q9BXW5
Ensembl ID ENSP00000363970
Symbol LC3 LC3A ATG8E MAP1ALC3 MAP1BLC3
FamilyBelongs to the ATG8 family.
Sequence
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp744937MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha9598VGNC:14258OMA, EggNOG
Mouse66734Map1lc3amicrotubule-associated protein 1 light chain 3 alpha10090MGI:1915661Inparanoid, OMA, EggNOG
Rat362245Map1lc3amicrotubule-associated protein 1 light chain 3 alpha10116RGD:735183Inparanoid, OMA
Dog477201MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha9615VGNC:54324Inparanoid, OMA, EggNOG
Horse100146217MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha9796VGNC:19923Inparanoid, OMA, EggNOG
Cow514547MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha9913VGNC:31179Inparanoid, OMA, EggNOG
Pig100322893MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha9823Inparanoid, OMA, EggNOG
Opossum100028493MAP1LC3Amicrotubule associated protein 1 light chain 3 alpha13616Inparanoid, EggNOG
PlatypusMAP1LC3Amicrotubule associated protein 1 light chain 3 alpha [Source:HGNC Symbol;Acc:HGNC:6838]9258OMA, EggNOG
Anole lizard100563996map1lc3amicrotubule associated protein 1 light chain 3 alpha28377Inparanoid, OMA, EggNOG
Xenopus493344map1lc3amicrotubule associated protein 1 light chain 3 alpha8364XB-GENE-941851Inparanoid, OMA, EggNOG
Zebrafish406466map1lc3amicrotubule-associated protein 1 light chain 3 alpha7955ZDB-GENE-040426-2232Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    cytoskeletal protein    /    non-motor microtubule binding protein    /    Microtubule-associated proteins 1A/1B light chain 3A
DTO Classes
protein    /    Cellular structure    /    Microtubule family cytoskeletal protein    /    Non-motor microtubule binding protein    /    Microtubule-associated proteins 1A/1B light chain 3A

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.