🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GLO1

DescripciónLactoylglutathione lyase

Gene and Protein Information

Gene ID2739
Uniprot Accession IDs Q04760 B2R6P7 B4DDV0 P78375 Q59EL0 Q5TZW3 Q96FC0 Q96J41
Ensembl ID ENSP00000362463
Symbol GLYI GLOD1 HEL-S-74
FamilyBelongs to the glyoxalase I family.
Sequence
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp748215GLO1glyoxalase I9598VGNC:2843OMA, EggNOG
Mouse109801Glo1glyoxalase 110090MGI:95742Inparanoid, OMA, EggNOG
Rat294320Glo1glyoxalase 110116RGD:2702Inparanoid, OMA, EggNOG
Dog474894GLO1glyoxalase I9615Inparanoid, OMA, EggNOG
Horse100065189GLO1glyoxalase I9796VGNC:49457Inparanoid, OMA, EggNOG
Cow540335GLO1glyoxalase I9913VGNC:50185Inparanoid, OMA, EggNOG
Pig100156085GLO1glyoxalase I9823Inparanoid, OMA, EggNOG
Opossum100029700GLO1glyoxalase I13616Inparanoid, OMA, EggNOG
Platypus100076218GLO1glyoxalase I9258Inparanoid, OMA, EggNOG
Chicken421428GLO1glyoxalase I9031CGNC:7697Inparanoid, OMA, EggNOG
Anole lizard100567895glo1glyoxalase I28377Inparanoid, OMA, EggNOG
Xenopus594942glo1glyoxalase 18364XB-GENE-995333Inparanoid, OMA
Zebrafish368213glo1glyoxalase 17955ZDB-GENE-030722-9Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.