🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

LSM1

DescripciónU6 snRNA-associated Sm-like protein LSm1

Gene and Protein Information

Gene ID27257
Uniprot Accession IDs O15116 B2R5E6
Ensembl ID ENSP00000310596
Symbol CASM CASM YJL124C
FamilyBelongs to the snRNP Sm proteins family.
Sequence
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp746776LSM1LSM1 homolog, mRNA degradation associated9598VGNC:1168OMA, EggNOG
Mouse67207Lsm1LSM1 homolog, mRNA degradation associated10090MGI:1914457Inparanoid, OMA, EggNOG
Rat364624Lsm1LSM1 homolog, mRNA degradation associated10116RGD:1304967Inparanoid, OMA, EggNOG
Dog475587LSM1LSM1 homolog, mRNA degradation associated9615VGNC:42838Inparanoid, OMA, EggNOG
Horse100057784LSM1LSM1 homolog, mRNA degradation associated9796VGNC:19815Inparanoid, OMA, EggNOG
Cow535447LSM1LSM1 homolog, mRNA degradation associated9913VGNC:31050Inparanoid, OMA, EggNOG
Platypus103170245LSM1LSM1 homolog, mRNA degradation associated9258Inparanoid, EggNOG
Chicken426775LSM1LSM1 homolog, mRNA degradation associated9031CGNC:2356OMA, EggNOG
Xenopus496613lsm1LSM1 homolog, mRNA degradation associated8364XB-GENE-971223Inparanoid, OMA, EggNOG
Zebrafish445157lsm1LSM1, U6 small nuclear RNA associated7955ZDB-GENE-040801-68Inparanoid, OMA, EggNOG
C. elegans174700lsm-1LSM Sm-like protein6239Inparanoid, OMA
Fruitfly37413LSm1Like Sm 17227FBgn0261067Inparanoid, EggNOG
S.cerevisiae853318LSM1Lsm1p4932S000003660Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    nuclease    /    U6 snRNA-associated Sm-like protein LSm1
protein    /    nucleic acid binding    /    mRNA splicing factor    /    U6 snRNA-associated Sm-like protein LSm1
DTO Classes
protein    /    Enzyme    /    Nuclease    /    U6 snRNA-associated Sm-like protein LSm1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.