🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

LSM2

DescripciónU6 snRNA-associated Sm-like protein LSm2

Gene and Protein Information

Gene ID57819
Uniprot Accession IDs Q9Y333 Q6FGG1
Ensembl ID ENSP00000364813
Symbol C6orf28 G7B G7B snRNP C6orf28 YBL026W
FamilyBelongs to the snRNP Sm proteins family.
Sequence
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp462569LSM2LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated9598VGNC:12652OMA, EggNOG
Macaque715592LSM2LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated9544Inparanoid, OMA, EggNOG
Mouse27756Lsm2LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated10090MGI:90676Inparanoid, OMA, EggNOG
Rat684148Lsm2LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated10116RGD:1598536Inparanoid, OMA, EggNOG
HorseLSM2LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:HGNC Symbol;Acc:HGNC:13940]9796OMA, EggNOG
Cow538662LSM2LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated9913VGNC:31054Inparanoid, OMA, EggNOG
Opossum100025239LSM2LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated13616Inparanoid, OMA, EggNOG
PlatypusLSM2LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated [Source:HGNC Symbol;Acc:HGNC:13940]9258OMA, EggNOG
Anole lizard100566131lsm2LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated28377Inparanoid, OMA, EggNOG
Xenopus549156lsm2LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated8364XB-GENE-483861Inparanoid, OMA, EggNOG
Zebrafish57924smx5smx57955ZDB-GENE-000616-10Inparanoid, OMA
C. elegans179833gut-2hypothetical protein6239Inparanoid, OMA
Fruitfly39408CG10418CG10418 gene product from transcript CG10418-RA7227FBgn0036277Inparanoid, EggNOG
S.cerevisiae852255LSM2Sm-like protein LSM24932S000000122Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    ribonucleoprotein    /    U6 snRNA-associated Sm-like protein LSm2
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    Ribonucleoprotein    /    U6 snRNA-associated Sm-like protein LSm2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.