🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

LIN28A

DescripciónProtein lin-28 homolog A

Gene and Protein Information

Gene ID79727
Uniprot Accession IDs Q9H9Z2 Lin-28A
Ensembl ID ENSP00000363314
Symbol CSDD1 LIN28 ZCCHC1 CSDD1 LIN28 LIN-28 ZCCHC1 lin-28A
FamilyBelongs to the lin-28 family.
Sequence
MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp456661LIN28Alin-28 homolog A9598VGNC:11510OMA, EggNOG
Mouse83557Lin28alin-28 homolog A (C. elegans)10090MGI:1890546Inparanoid, OMA, EggNOG
Rat500562Lin28alin-28 homolog A10116RGD:1566408Inparanoid, OMA
Dog612162LIN28Alin-28 homolog A9615VGNC:42683Inparanoid, OMA, EggNOG
Horse100071098LIN28Alin-28 homolog A9796VGNC:19673Inparanoid, OMA, EggNOG
Cow614997LIN28Alin-28 homolog A9913Inparanoid, OMA, EggNOG
Pig100142662LIN28Alin-28 homolog A9823OMA, EggNOG
Opossum100012320LIN28Alin-28 homolog A13616Inparanoid, OMA, EggNOG
Anole lizard100554583lin28alin-28 homolog A28377Inparanoid, EggNOG
Xenopus548523lin28alin-28 homolog A8364XB-GENE-491384Inparanoid, OMA, EggNOG
Zebrafish799825si:ch1073-284b18.2si:ch1073-284b18.27955ZDB-GENE-110914-157OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.