SLC25A11

DescripciónMitochondrial 2-oxoglutarate/malate carrier protein

Gene and Protein Information

Gene ID8402
Uniprot Accession IDs Q02978 F5GY65 O75537 Q969P7 OGCP
Ensembl ID ENSP00000225665
Symbol SLC20A4 OGC SLC20A4
FamilyBelongs to the mitochondrial carrier (TC 2.A.29) family.
Sequence
MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp468167SLC25A11solute carrier family 25 member 119598VGNC:9619OMA, EggNOG
Macaque710569SLC25A11solute carrier family 25 member 119544Inparanoid, OMA, EggNOG
Mouse67863Slc25a11solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 1110090MGI:1915113Inparanoid, OMA, EggNOG
Rat64201Slc25a11solute carrier family 25 member 1110116RGD:708476Inparanoid, OMA, EggNOG
Dog479470SLC25A11solute carrier family 25 member 119615VGNC:46291Inparanoid, OMA, EggNOG
Horse100061330SLC25A11solute carrier family 25 member 119796VGNC:23090Inparanoid, OMA, EggNOG
Cow282523SLC25A11solute carrier family 25 member 119913VGNC:34742Inparanoid, OMA, EggNOG
Opossum100017448SLC25A11solute carrier family 25 member 1113616Inparanoid, OMA, EggNOG
Anole lizardSLC25A11solute carrier family 25 member 11 [Source:HGNC Symbol;Acc:HGNC:10981]28377Inparanoid, EggNOG
Xenopus496602rangrfRAN guanine nucleotide release factor8364XB-GENE-5760490Inparanoid, OMA, EggNOG
Zebrafish415189slc25a11solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 117955ZDB-GENE-040625-79Inparanoid, OMA, EggNOG
C. elegans173414misc-1MItochondrial Solute Carrier6239Inparanoid, OMA, EggNOG
Fruitfly43483CG1907CG1907 gene product from transcript CG1907-RA7227FBgn0039674Inparanoid, EggNOG

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC25 family of mitochondrial transporters    /    Mitochondrial di- and tri-carboxylic acid transporter subfamily    /    Mitochondrial 2-oxoglutarate/malate carrier protein

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.