224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Mitochondrial 2-oxoglutarate/malate carrier protein |
|---|
Gene and Protein Information
| Gene ID | 8402 |
|---|---|
| Uniprot Accession IDs | Q02978 F5GY65 O75537 Q969P7 OGCP |
| Ensembl ID | ENSP00000225665 |
| Symbol | SLC20A4 OGC SLC20A4 |
| Family | Belongs to the mitochondrial carrier (TC 2.A.29) family. |
| Sequence | MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468167 | SLC25A11 | solute carrier family 25 member 11 | 9598 | VGNC:9619 | OMA, EggNOG |
| Macaque | 710569 | SLC25A11 | solute carrier family 25 member 11 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 67863 | Slc25a11 | solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 11 | 10090 | MGI:1915113 | Inparanoid, OMA, EggNOG |
| Rat | 64201 | Slc25a11 | solute carrier family 25 member 11 | 10116 | RGD:708476 | Inparanoid, OMA, EggNOG |
| Dog | 479470 | SLC25A11 | solute carrier family 25 member 11 | 9615 | VGNC:46291 | Inparanoid, OMA, EggNOG |
| Horse | 100061330 | SLC25A11 | solute carrier family 25 member 11 | 9796 | VGNC:23090 | Inparanoid, OMA, EggNOG |
| Cow | 282523 | SLC25A11 | solute carrier family 25 member 11 | 9913 | VGNC:34742 | Inparanoid, OMA, EggNOG |
| Opossum | 100017448 | SLC25A11 | solute carrier family 25 member 11 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | SLC25A11 | solute carrier family 25 member 11 [Source:HGNC Symbol;Acc:HGNC:10981] | 28377 | Inparanoid, EggNOG | ||
| Xenopus | 496602 | rangrf | RAN guanine nucleotide release factor | 8364 | XB-GENE-5760490 | Inparanoid, OMA, EggNOG |
| Zebrafish | 415189 | slc25a11 | solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 | 7955 | ZDB-GENE-040625-79 | Inparanoid, OMA, EggNOG |
| C. elegans | 173414 | misc-1 | MItochondrial Solute Carrier | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 43483 | CG1907 | CG1907 gene product from transcript CG1907-RA | 7227 | FBgn0039674 | Inparanoid, EggNOG |
Protein Classes
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial di- and tri-carboxylic acid transporter subfamily / Mitochondrial 2-oxoglutarate/malate carrier protein
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial di- and tri-carboxylic acid transporter subfamily / Mitochondrial 2-oxoglutarate/malate carrier protein
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.