🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

MSRB3

DescripciónMethionine-R-sulfoxide reductase B3

Gene and Protein Information

Gene ID253827
Uniprot Accession IDs Q8IXL7 B4DR19 B7ZAQ0 Q6UXS2 MsrB3
Ensembl ID ENSP00000347324
Symbol DFNB74
FamilyBelongs to the MsrB Met sulfoxide reductase family.
Sequence
MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp744605MSRB3methionine sulfoxide reductase B39598VGNC:13422OMA, EggNOG
Macaque717617MSRB3methionine sulfoxide reductase B39544Inparanoid, OMA, EggNOG
Mouse320183Msrb3methionine sulfoxide reductase B310090MGI:2443538Inparanoid, OMA, EggNOG
Rat680036Msrb3methionine sulfoxide reductase B310116RGD:1596851OMA, EggNOG
Dog608386MSRB3methionine sulfoxide reductase B39615VGNC:43451Inparanoid, OMA, EggNOG
HorseMSRB3methionine sulfoxide reductase B3 [Source:HGNC Symbol;Acc:HGNC:27375]9796OMA, EggNOG
Cow617849MSRB3methionine sulfoxide reductase B39913VGNC:54457Inparanoid, OMA, EggNOG
Pig100511693MSRB3methionine sulfoxide reductase B39823OMA, EggNOG
Platypus100079557MSRB3methionine sulfoxide reductase B39258OMA, EggNOG
Chicken417833MSRB3methionine sulfoxide reductase B39031CGNC:13069Inparanoid, OMA
Anole lizard100553315msrb3methionine sulfoxide reductase B328377Inparanoid, OMA, EggNOG
Zebrafish415184msrb3methionine sulfoxide reductase B37955ZDB-GENE-040625-74Inparanoid, OMA, EggNOG
Fruitfly41309SelRSelenoprotein R7227FBgn0267376Inparanoid, EggNOG
S.cerevisiae850324MXR2Mxr2p4932S000000538Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.