224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | GDP-fucose protein O-fucosyltransferase 1 |
|---|
Gene and Protein Information
| Gene ID | 23509 |
|---|---|
| Uniprot Accession IDs | Q9H488 A8K4R8 E1P5M4 Q14685 Q5W185 Q9BW76 |
| Ensembl ID | ENSP00000364902 |
| Symbol | FUT12 KIAA0180 DDD2 FUT12 O-FUT OFUCT1 O-Fuc-T O-FucT-1 |
| Family | Belongs to the glycosyltransferase 65 family. |
| Sequence | MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTMTMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 449504 | POFUT1 | protein O-fucosyltransferase 1 | 9598 | VGNC:14278 | Inparanoid, OMA, EggNOG |
| Macaque | 711966 | POFUT1 | protein O-fucosyltransferase 1 | 9544 | OMA, EggNOG | |
| Mouse | 140484 | Pofut1 | protein O-fucosyltransferase 1 | 10090 | MGI:2153207 | Inparanoid, OMA, EggNOG |
| Rat | 311551 | Pofut1 | protein O-fucosyltransferase 1 | 10116 | RGD:1303001 | Inparanoid, OMA, EggNOG |
| Dog | 609881 | POFUT1 | protein O-fucosyltransferase 1 | 9615 | VGNC:44767 | Inparanoid, OMA, EggNOG |
| Horse | 100068638 | POFUT1 | protein O-fucosyltransferase 1 | 9796 | VGNC:21645 | Inparanoid, OMA, EggNOG |
| Cow | 360194 | POFUT1 | protein O-fucosyltransferase 1 | 9913 | VGNC:33105 | Inparanoid, OMA, EggNOG |
| Pig | 397627 | POFUT1 | protein O-fucosyltransferase 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100010283 | POFUT1 | protein O-fucosyltransferase 1 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100088179 | POFUT1 | protein O-fucosyltransferase 1 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 395070 | POFUT1 | protein O-fucosyltransferase 1 | 9031 | CGNC:4973 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557912 | pofut1 | protein O-fucosyltransferase 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496411 | pofut1 | protein O-fucosyltransferase 1 | 8364 | XB-GENE-979243 | Inparanoid, OMA, EggNOG |
| Zebrafish | 403029 | pofut1 | protein O-fucosyltransferase 1 | 7955 | ZDB-GENE-040303-2 | Inparanoid, OMA, EggNOG |
| C. elegans | 180607 | C15C7.7 | GDP-fucose protein O-fucosyltransferase 1 | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 36564 | O-fut1 | O-fucosyltransferase 1 | 7227 | FBgn0033901 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.