🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

JUND

DescripciónTranscription factor jun-D

Gene and Protein Information

Gene ID3727
Uniprot Accession IDs P17535 Q53EK9
Ensembl ID ENSP00000252818
Symbol AP-1
FamilyBelongs to the bZIP family. Jun subfamily.
Sequence
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse16478Jundjun D proto-oncogene10090MGI:96648Inparanoid, OMA, EggNOG
Rat24518JundJunD proto-oncogene, AP-1 transcription factor subunit10116RGD:2945Inparanoid, OMA, EggNOG
Dog609409JUNDJunD proto-oncogene, AP-1 transcription factor subunit9615VGNC:42199Inparanoid, OMA
OpossumJUNDJunD proto-oncogene, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:6206]13616Inparanoid, OMA
Xenopus100126216jundjun D proto-oncogene8364XB-GENE-955776Inparanoid, OMA
Zebrafish564873jundJunD proto-oncogene, AP-1 transcription factor subunit7955ZDB-GENE-070725-2Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    basic leucine zipper transcription factor    /    Transcription factor jun-D
protein    /    transcription factor    /    nucleic acid binding    /    Transcription factor jun-D
DTO Classes
protein    /    Transcription factor    /    Basic leucine zipper transcription factor    /    Transcription factor jun-D

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.