224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Nuclear receptor subfamily 4 group A member 2 |
|---|
Gene and Protein Information
| Gene ID | 4929 |
|---|---|
| Uniprot Accession IDs | P43354 Q16311 Q53RZ2 Q6NXU0 |
| Ensembl ID | ENSP00000344479 |
| Symbol | NOT NURR1 TINUR NOT RNR1 HZF-3 NURR1 TINUR |
| Family | Belongs to the nuclear hormone receptor family. NR4 subfamily. |
| Sequence | MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459669 | NR4A2 | nuclear receptor subfamily 4 group A member 2 | 9598 | VGNC:2728 | OMA, EggNOG |
| Macaque | 697077 | NR4A2 | nuclear receptor subfamily 4 group A member 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 18227 | Nr4a2 | nuclear receptor subfamily 4, group A, member 2 | 10090 | MGI:1352456 | Inparanoid, OMA, EggNOG |
| Rat | 54278 | Nr4a2 | nuclear receptor subfamily 4, group A, member 2 | 10116 | RGD:3202 | Inparanoid, OMA, EggNOG |
| Dog | 478754 | NR4A2 | nuclear receptor subfamily 4 group A member 2 | 9615 | VGNC:43955 | Inparanoid, OMA, EggNOG |
| Horse | 100050666 | NR4A2 | nuclear receptor subfamily 4 group A member 2 | 9796 | VGNC:20872 | Inparanoid, OMA, EggNOG |
| Cow | 540245 | NR4A2 | nuclear receptor subfamily 4 group A member 2 | 9913 | VGNC:32246 | Inparanoid, OMA, EggNOG |
| Pig | 100157120 | NR4A2 | nuclear receptor subfamily 4 group A member 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100014732 | NR4A2 | nuclear receptor subfamily 4 group A member 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | NR4A2 | nuclear receptor subfamily 4 group A member 2 [Source:HGNC Symbol;Acc:HGNC:7981] | 9258 | OMA, EggNOG | ||
| Chicken | 424320 | NR4A2 | nuclear receptor subfamily 4 group A member 2 | 9031 | CGNC:9517 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552871 | nr4a2 | nuclear receptor subfamily 4 group A member 2 | 28377 | Inparanoid, OMA | |
| Xenopus | 100101682 | nr4a2 | nuclear receptor subfamily 4 group A member 2 | 8364 | XB-GENE-480893 | Inparanoid, EggNOG |
| Zebrafish | 100008101 | nr4a2a | nuclear receptor subfamily 4, group A, member 2a | 7955 | ZDB-GENE-990415-184 | Inparanoid, OMA |
| Fruitfly | 35332 | Hr38 | Hormone receptor-like in 38 | 7227 | FBgn0014859 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.