224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Mitochondrial pyruvate carrier 1-like protein |
|---|
Gene and Protein Information
| Gene ID | 347411 |
|---|---|
| Uniprot Accession IDs | P0DKB6 |
| Symbol | SLC54A3 |
| Family | Belongs to the mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family. |
| Sequence | MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTALILYSAIFMRFAYRVQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| S.cerevisiae | 852800 | MPC1 | pyruvate transporter MPC1 | 4932 | S000003048 | Inparanoid, OMA |
Protein Classes
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC54 Mitochondrial pyruvate carriers / Mitochondrial pyruvate carrier 1-like protein
protein / Transporter / SLC superfamily of solute carriers / SLC54 Mitochondrial pyruvate carriers / Mitochondrial pyruvate carrier 1-like protein
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.