Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Dynein light chain Tctex-type 1 |
|---|
Gene and Protein Information
| Gene ID | 6993 |
|---|---|
| Uniprot Accession IDs | P63172 Q15763 Q5VTU4 |
| Ensembl ID | ENSP00000356056 |
| Symbol | TCTEL1 TCTEX-1 TCTEX1 CW-1 TCTEL1 tctex-1 |
| Family | Belongs to the dynein light chain Tctex-type family. |
| Sequence | MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463098 | DYNLT1 | dynein light chain Tctex-type 1 | 9598 | VGNC:8717 | OMA, EggNOG |
| Macaque | 106998065 | DYNLT1 | dynein light chain Tctex-type 1 | 9544 | OMA, EggNOG | |
| Mouse | 21648 | Dynlt1b | dynein light chain Tctex-type 1B | 10090 | MGI:98643 | Inparanoid, OMA |
| Mouse | 100040531 | Dynlt1f | dynein light chain Tctex-type 1F | 10090 | MGI:3780996 | OMA, EggNOG |
| Rat | 83462 | Dynlt1 | dynein light chain Tctex-type 1 | 10116 | RGD:620261 | Inparanoid, OMA, EggNOG |
| Horse | 100059508 | DYNLT1 | dynein light chain Tctex-type 1 | 9796 | VGNC:17374 | OMA, EggNOG |
| Cow | 282380 | DYNLT1 | dynein light chain Tctex-type 1 | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100027715 | DYNLT1 | dynein light chain Tctex-type 1 | 13616 | OMA, EggNOG | |
| Platypus | 100084499 | DYNLT1 | dynein light chain Tctex-type 1 | 9258 | OMA, EggNOG | |
| Chicken | 421660 | DYNLT1 | dynein light chain Tctex-type 1 | 9031 | CGNC:14053 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556758 | dynlt1 | dynein light chain Tctex-type 1 | 28377 | OMA, EggNOG | |
| Zebrafish | 100318879 | si:dkey-148f10.4 | si:dkey-148f10.4 | 7955 | ZDB-GENE-060503-292 | Inparanoid, OMA, EggNOG |
| Fruitfly | 42199 | Dlc90F | Dynein light chain 90F | 7227 | FBgn0024432 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Dynein light chain Tctex-type 1
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Dynein light chain Tctex-type 1
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Dynein light chain Tctex-type 1
protein / Cellular structure / Microtubule family cytoskeletal protein / Dynein light chain Tctex-type 1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.