🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

C1QA

DescripciónComplement C1q subcomponent subunit A

Gene and Protein Information

Gene ID712
Uniprot Accession IDs P02745 B2R4X2 Q5T963
Ensembl ID ENSP00000363773
Sequence
MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp749231C1QAcomplement C1q A chain9598VGNC:12979OMA, EggNOG
Mouse12259C1qacomplement component 1, q subcomponent, alpha polypeptide10090MGI:88223Inparanoid, OMA, EggNOG
Rat298566C1qacomplement C1q A chain10116RGD:1306716Inparanoid, OMA, EggNOG
Dog478194C1QAcomplement C1q A chain9615VGNC:38576Inparanoid, OMA, EggNOG
Horse100058097C1QAcomplement C1q A chain9796VGNC:15936Inparanoid, OMA, EggNOG
Cow534961C1QAcomplement C1q A chain9913VGNC:26616Inparanoid, OMA, EggNOG
Pig445461C1QAcomplement C1q A chain9823Inparanoid, OMA, EggNOG
Opossum100025524C1QAcomplement C1q A chain13616Inparanoid, OMA, EggNOG
Chicken419504C1QAcomplement C1q A chain9031CGNC:14626OMA, EggNOG
Anole lizard100556677LOC100556677complement C1q subcomponent subunit A28377OMA, EggNOG
Xenopusc1qacomplement component 1, q subcomponent, A chain [Source:Xenbase;Acc:XB-GENE-6039250]8364OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.