224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Carbonic anhydrase 6 |
|---|
Gene and Protein Information
| Gene ID | 765 |
|---|---|
| Uniprot Accession IDs | P23280 E7EMQ1 Q5FBW3 Q5FC00 Q96QX8 Q9UF03 |
| Ensembl ID | ENSP00000366654 |
| Symbol | CA-VI GUSTIN |
| Family | Belongs to the alpha-carbonic anhydrase family. |
| Sequence | MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457915 | CA6 | carbonic anhydrase 6 | 9598 | VGNC:9850 | OMA, EggNOG |
| Macaque | 709540 | CA6 | carbonic anhydrase 6 | 9544 | OMA, EggNOG | |
| Mouse | 12353 | Car6 | carbonic anhydrase 6 | 10090 | MGI:1333786 | Inparanoid, OMA, EggNOG |
| Rat | 298657 | Car6 | carbonic anhydrase 6 | 10116 | RGD:70516 | Inparanoid, OMA, EggNOG |
| Dog | 403503 | CA6 | carbonic anhydrase 6 | 9615 | VGNC:38614 | Inparanoid, OMA, EggNOG |
| Horse | 100051818 | CA6 | carbonic anhydrase 6 | 9796 | VGNC:15966 | Inparanoid, OMA, EggNOG |
| Cow | 280742 | CA6 | carbonic anhydrase 6 | 9913 | VGNC:26656 | Inparanoid, OMA, EggNOG |
| Pig | 100240717 | CA6 | carbonic anhydrase 6 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100617216 | CA6 | carbonic anhydrase 6 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 779937 | ca6 | carbonic anhydrase 6 | 8364 | XB-GENE-494019 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.