🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CA1

DescripciónCarbonic anhydrase 1

Gene and Protein Information

Gene ID759
Uniprot Accession IDs P00915
Ensembl ID ENSP00000430656
Symbol CAB CA-I Car1 HEL-S-11
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp464264CA1carbonic anhydrase 19598VGNC:10213Inparanoid, OMA
Macaque703701CA1carbonic anhydrase 19544Inparanoid, OMA
Mouse12346Car1carbonic anhydrase 110090MGI:88268Inparanoid, OMA
Rat310218Car1carbonic anhydrase I10116RGD:1309780Inparanoid, OMA
Dog487031CA1carbonic anhydrase 19615VGNC:38604Inparanoid, OMA
Cow510801CA1carbonic anhydrase I9913Inparanoid, OMA
Opossum497246CA1carbonic anhydrase 113616Inparanoid, OMA
Xenopus100496485ca1carbonic anhydrase I8364XB-GENE-957160Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.