Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Caveolin-3 |
|---|
Gene and Protein Information
| Gene ID | 859 |
|---|---|
| Uniprot Accession IDs | P56539 A8K777 Q3T1A4 |
| Ensembl ID | ENSP00000341940 |
| Symbol | LQT9 MPDT RMD2 VIP21 LGMD1C VIP-21 |
| Family | Belongs to the caveolin family. |
| Sequence | MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 738786 | CAV3 | caveolin 3 | 9598 | VGNC:1753 | OMA, EggNOG |
| Macaque | 702163 | CAV3 | caveolin 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12391 | Cav3 | caveolin 3 | 10090 | MGI:107570 | Inparanoid, OMA, EggNOG |
| Rat | 29161 | Cav3 | caveolin 3 | 10116 | RGD:2281 | Inparanoid, OMA, EggNOG |
| Dog | 484671 | CAV3 | caveolin 3 | 9615 | VGNC:38753 | Inparanoid, OMA, EggNOG |
| Horse | CAV3 | caveolin 3 [Source:HGNC Symbol;Acc:HGNC:1529] | 9796 | OMA, EggNOG | ||
| Cow | 615310 | CAV3 | caveolin 3 | 9913 | VGNC:26801 | Inparanoid, OMA, EggNOG |
| Opossum | 100023521 | CAV3 | caveolin 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 378796 | CAV3 | caveolin 3 | 9031 | CGNC:6328 | Inparanoid, OMA |
| Anole lizard | 100552705 | LOC100552705 | caveolin-3-like | 28377 | OMA, EggNOG | |
| Xenopus | 100125124 | cav3.1 | caveolin 3, gene 1 | 8364 | XB-GENE-962905 | Inparanoid, OMA |
| Xenopus | 100124941 | cav3.2 | caveolin 3, gene 2 | 8364 | XB-GENE-5815090 | OMA, EggNOG |
| Zebrafish | 449679 | cav3 | caveolin 3 | 7955 | ZDB-GENE-050522-426 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / G-protein modulator / Caveolin-3
protein / enzyme modulator / membrane traffic protein / Caveolin-3
protein / enzyme modulator / structural protein / Caveolin-3
protein / enzyme modulator / transmembrane receptor regulatory/adaptor protein / Caveolin-3
protein / enzyme modulator / G-protein modulator / Caveolin-3
protein / enzyme modulator / membrane traffic protein / Caveolin-3
protein / enzyme modulator / structural protein / Caveolin-3
protein / enzyme modulator / transmembrane receptor regulatory/adaptor protein / Caveolin-3
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.