🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

BTLA

DescripciónB- and T-lymphocyte attenuator

Gene and Protein Information

Gene ID151888
Uniprot Accession IDs Q7Z6A9 Q3B831 Q3HS85 Q6ZNH9
Ensembl ID ENSP00000333919
Symbol BTLA1 CD272
Sequence
MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp460584BTLAB and T lymphocyte associated9598VGNC:1749OMA, EggNOG
Macaque708202BTLAB and T lymphocyte associated9544Inparanoid, OMA, EggNOG
Mouse208154BtlaB and T lymphocyte associated10090MGI:2658978Inparanoid, OMA, EggNOG
Rat407756BtlaB and T lymphocyte associated10116RGD:1303280Inparanoid, OMA, EggNOG
Dog487975BTLAB and T lymphocyte associated9615VGNC:38561Inparanoid, OMA, EggNOG
Horse100071491BTLAB and T lymphocyte associated9796VGNC:15921Inparanoid, OMA, EggNOG
Cow531767BTLAB and T lymphocyte associated9913VGNC:26602OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.