224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Uncharacterized protein C1orf43 |
|---|
Gene and Protein Information
| Gene ID | 25912 |
|---|---|
| Uniprot Accession IDs | Q9BWL3 A8K3G8 D3DV72 D3DV74 Q5M801 Q5VU73 Q5VU83 Q96HP7 Q9UFU2 Q9UGL7 Q9UGL8 Q9Y2R6 |
| Ensembl ID | ENSP00000357507 |
| Symbol | NICE3 NS5ATP4 NICE3 NICE-3 S863-3 HSPC012 NS5ATP4 |
| Sequence | MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSEGRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELKSFKDNYNTLESTL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469503 | C1H1orf43 | chromosome 1 C1orf43 homolog | 9598 | VGNC:4998 | OMA, EggNOG |
| Macaque | 716453 | C1H1orf43 | chromosome 1 open reading frame, human C1orf43 | 9544 | OMA, EggNOG | |
| Mouse | 99650 | 4933434E20Rik | RIKEN cDNA 4933434E20 gene | 10090 | MGI:1914027 | Inparanoid, OMA, EggNOG |
| Rat | 361985 | LOC361985 | similar to NICE-3 | 10116 | RGD:1359625 | Inparanoid, OMA |
| Dog | C1orf43 | chromosome 1 open reading frame 43 [Source:HGNC Symbol;Acc:HGNC:29876] | 9615 | OMA, EggNOG | ||
| Horse | 100056786 | LOC100056786 | uncharacterized protein C1orf43 homolog | 9796 | OMA, EggNOG | |
| Cow | 538459 | C3H1orf43 | chromosome 3 open reading frame, human C1orf43 | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100015479 | C2H1orf43 | chromosome 2 open reading frame, human C1orf43 | 13616 | OMA, EggNOG | |
| Xenopus | 100145061 | c1orf43 | chromosome 1 open reading frame 43 | 8364 | XB-GENE-1009268 | OMA, EggNOG |
| Zebrafish | 562761 | zgc:123238 | zgc:123238 | 7955 | ZDB-GENE-051023-3 | Inparanoid, OMA, EggNOG |
| Fruitfly | 36903 | CG6665 | CG6665 gene product from transcript CG6665-RC | 7227 | FBgn0034172 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.