🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CA12

DescripciónCarbonic anhydrase 12

Gene and Protein Information

Gene ID771
Uniprot Accession IDs O43570 B2RE24 Q53YE5 Q9BWG2
Ensembl ID ENSP00000178638
Symbol CAXII CA-XII T18816 HsT18816
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque705838CA12carbonic anhydrase 129544Inparanoid, OMA, EggNOG
Mouse76459Car12carbonic anhydrase 1210090MGI:1923709OMA, EggNOG
Rat363085Car12carbonic anhydrase 1210116RGD:1306612Inparanoid, OMA, EggNOG
Dog478333CA12carbonic anhydrase 129615VGNC:38607Inparanoid, OMA, EggNOG
Horse100054028CA12carbonic anhydrase 129796VGNC:15961Inparanoid, OMA, EggNOG
Cow614323CA12carbonic anhydrase 129913VGNC:26650Inparanoid, OMA, EggNOG
Pig100152749CA12carbonic anhydrase 129823OMA, EggNOG
Opossum100023076CA12carbonic anhydrase 1213616Inparanoid, EggNOG
PlatypusCA12carbonic anhydrase 12 [Source:HGNC Symbol;Acc:HGNC:1371]9258OMA, EggNOG
Chicken415370CA12carbonic anhydrase 129031CGNC:2518Inparanoid, OMA
Anole lizard100567887ca12carbonic anhydrase 1228377Inparanoid, OMA, EggNOG
Xenopus549185ca12carbonic anhydrase XII8364XB-GENE-1015246Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.