🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

BOK

DescripciónBcl-2-related ovarian killer protein

Gene and Protein Information

Gene ID666
Uniprot Accession IDs Q9UMX3 hBOK
Ensembl ID ENSP00000314132
Symbol BCL2L9 BOKL BCL2L9
FamilyBelongs to the Bcl-2 family.
Sequence
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp100614689BOKBOK, BCL2 family apoptosis regulator9598VGNC:14311OMA, EggNOG
Mouse51800BokBCL2-related ovarian killer10090MGI:1858494Inparanoid, OMA, EggNOG
Rat29884BokBOK, BCL2 family apoptosis regulator10116RGD:70984Inparanoid, OMA, EggNOG
HorseBOKBOK, BCL2 family apoptosis regulator [Source:HGNC Symbol;Acc:HGNC:1087]9796OMA, EggNOG
Cow504851BOKBOK, BCL2 family apoptosis regulator9913VGNC:26538Inparanoid, OMA, EggNOG
Opossum100014090BOKBOK, BCL2 family apoptosis regulator13616Inparanoid, OMA, EggNOG
Platypus100080424BOKBOK, BCL2 family apoptosis regulator9258Inparanoid, OMA, EggNOG
Chicken395445BOKBOK, BCL2 family apoptosis regulator9031CGNC:4304Inparanoid, OMA, EggNOG
Anole lizard100553048bokBOK, BCL2 family apoptosis regulator28377Inparanoid, OMA, EggNOG
Xenopus100491111bokBOK, BCL2 family apoptosis regulator8364XB-GENE-988663OMA, EggNOG
Zebrafish445218bokaBOK, BCL2 family apoptosis regulator a7955ZDB-GENE-040801-131Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.