🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

BMF

DescripciónBcl-2-modifying factor

Gene and Protein Information

Gene ID90427
Uniprot Accession IDs Q96LC9 Q2M396 Q6NT30 Q6NT56 Q6P9F6 Q7Z7D4 Q7Z7D5 Q9H7K7
Ensembl ID ENSP00000346697
FamilyBelongs to the Bcl-2 family.
Sequence
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp453323BMFBcl2 modifying factor9598VGNC:6460OMA, EggNOG
Macaque706239BMFBcl2 modifying factor9544Inparanoid, OMA, EggNOG
Mouse171543BmfBCL2 modifying factor10090MGI:2176433Inparanoid, OMA, EggNOG
Rat246142BmfBcl2 modifying factor10116RGD:628658Inparanoid, OMA
Dog607313BMFBcl2 modifying factor9615VGNC:38474Inparanoid, OMA, EggNOG
Horse100057359BMFBcl2 modifying factor9796VGNC:15843Inparanoid, OMA, EggNOG
Cow541141BMFBcl2 modifying factor9913VGNC:26513Inparanoid, OMA, EggNOG
Opossum100031831BMFBcl2 modifying factor13616Inparanoid, EggNOG
Chicken769140BMFBcl2 modifying factor9031CGNC:10799Inparanoid, OMA, EggNOG
Anole lizard100555155bmfBcl2 modifying factor28377Inparanoid, OMA, EggNOG
Xenopus100495515bmfBcl2 modifying factor8364XB-GENE-982389Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.