🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

BTF3L4

DescripciónTranscription factor BTF3 homolog 4

Gene and Protein Information

Gene ID91408
Uniprot Accession IDs Q96K17 B3KNJ1 D3DQ32 G3V1C6
Ensembl ID ENSP00000360664
FamilyBelongs to the NAC-beta family.
Sequence
MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp456854BTF3L4basic transcription factor 3 like 49598VGNC:11735OMA, EggNOG
Mouse70533Btf3l4basic transcription factor 3-like 410090MGI:1915312Inparanoid, OMA, EggNOG
Rat366434Btf3l4basic transcription factor 3-like 410116RGD:1311774Inparanoid, OMA
Dog100687058BTF3L4basic transcription factor 3 like 49615VGNC:38557Inparanoid, OMA, EggNOG
Horse100050901BTF3L4basic transcription factor 3 like 49796VGNC:15918Inparanoid, OMA, EggNOG
Cow539753BTF3L4basic transcription factor 3 like 49913VGNC:26596Inparanoid, OMA, EggNOG
Opossum100019175BTF3L4basic transcription factor 3 like 413616OMA, EggNOG
Platypus100077312BTF3L4basic transcription factor 3 like 49258Inparanoid, OMA, EggNOG
Chicken424638BTF3L4basic transcription factor 3 like 49031CGNC:8026Inparanoid, OMA, EggNOG
Anole lizard100562283btf3l4basic transcription factor 3 like 428377Inparanoid, OMA, EggNOG
Xenopus496686btf3l4basic transcription factor 3-like 48364XB-GENE-948236Inparanoid, OMA, EggNOG
Zebrafish393667btf3l4basic transcription factor 3-like 47955ZDB-GENE-040426-1650Inparanoid, OMA
C. elegans174090icd-1Transcription factor BTF3 homolog6239OMA, EggNOG
S.cerevisiae856070EGD1Egd1p4932S000005958OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.