🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CA14

DescripciónCarbonic anhydrase 14

Gene and Protein Information

Gene ID23632
Uniprot Accession IDs Q9ULX7 Q5TB24 Q8NCF4
Ensembl ID ENSP00000358107
Symbol CAXiV
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469479CA14carbonic anhydrase 149598VGNC:9849OMA, EggNOG
Macaque706360CA14carbonic anhydrase 149544Inparanoid, OMA, EggNOG
Mouse23831Car14carbonic anhydrase 1410090MGI:1344341Inparanoid, OMA, EggNOG
Rat791259Car14carbonic anhydrase 1410116RGD:1599277Inparanoid, OMA, EggNOG
Dog100855809CA14carbonic anhydrase 149615VGNC:38609Inparanoid, OMA, EggNOG
Horse100054535CA14carbonic anhydrase 149796VGNC:15962Inparanoid, OMA, EggNOG
Cow509027CA14carbonic anhydrase 149913VGNC:26652Inparanoid, OMA, EggNOG
Pig100153371CA14carbonic anhydrase 149823OMA, EggNOG
Opossum100016752CA14carbonic anhydrase 1413616Inparanoid, OMA, EggNOG
Xenopus100126213ca14carbonic anhydrase 148364XB-GENE-855636Inparanoid, OMA, EggNOG
Zebrafish567897ca14carbonic anhydrase XIV7955ZDB-GENE-051030-57Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.