🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

BLNK

DescripciónB-cell linker protein

Gene and Protein Information

Gene ID29760
Uniprot Accession IDs Q8WV28 O75498 O75499 Q2MD49
Ensembl ID ENSP00000224337
Symbol BASH SLP65 bca AGM4 BASH LY57 SLP65 BLNK-S SLP-65
Sequence
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp450641BLNKB cell linker9598VGNC:3815OMA, EggNOG
Macaque704363BLNKB-cell linker9544Inparanoid, OMA, EggNOG
Mouse17060BlnkB cell linker10090MGI:96878Inparanoid, OMA, EggNOG
Rat499356BlnkB-cell linker10116RGD:1561933Inparanoid, OMA, EggNOG
Dog486814BLNKB cell linker9615VGNC:38466Inparanoid, OMA, EggNOG
Horse100070841BLNKB cell linker9796VGNC:50578Inparanoid, OMA
Cow510393BLNKB cell linker9913VGNC:26506Inparanoid, OMA, EggNOG
Pig100152350BLNKB-cell linker9823Inparanoid, OMA, EggNOG
Chicken395733BLNKB-cell linker9031CGNC:5261Inparanoid, OMA, EggNOG
Anole lizard100561263blnkB-cell linker28377Inparanoid, OMA, EggNOG
Xenopus548350blnkB cell linker8364XB-GENE-946366Inparanoid, OMA, EggNOG
Zebrafish405764blnkB cell linker7955ZDB-GENE-040702-4Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.