Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Homeobox protein DLX-5 |
|---|
Gene and Protein Information
| Gene ID | 1749 |
|---|---|
| Uniprot Accession IDs | P56178 B7Z4P3 Q9UPL1 |
| Ensembl ID | ENSP00000222598 |
| Symbol | SHFM1D |
| Family | Belongs to the distal-less homeobox family. |
| Sequence | MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463554 | DLX5 | distal-less homeobox 5 | 9598 | VGNC:4331 | OMA, EggNOG |
| Mouse | 13395 | Dlx5 | distal-less homeobox 5 | 10090 | MGI:101926 | Inparanoid, OMA, EggNOG |
| Rat | 25431 | Dlx5 | distal-less homeobox 5 | 10116 | RGD:2506 | Inparanoid, OMA, EggNOG |
| Dog | 482313 | DLX5 | distal-less homeobox 5 | 9615 | VGNC:39992 | Inparanoid, OMA, EggNOG |
| Horse | 100052263 | DLX5 | distal-less homeobox 5 | 9796 | VGNC:17222 | Inparanoid, OMA, EggNOG |
| Cow | 507415 | DLX5 | distal-less homeobox 5 | 9913 | VGNC:28101 | Inparanoid, OMA, EggNOG |
| Opossum | 100012748 | DLX5 | distal-less homeobox 5 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 373969 | DLX5 | distal-less homeobox 5 | 9031 | CGNC:48983 | Inparanoid, OMA |
| Anole lizard | 100561571 | dlx5 | distal-less homeobox 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 447997 | dlx5 | distal-less homeobox 5 | 8364 | XB-GENE-853057 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30569 | dlx5a | distal-less homeobox 5a | 7955 | ZDB-GENE-990415-49 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Homeobox protein DLX-5
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein DLX-5
protein / nucleic acid binding / DNA binding protein / Homeobox protein DLX-5
protein / nucleic acid binding / homeodomain transcription factor / Homeobox protein DLX-5
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein DLX-5
protein / Transcription factor / Helix-turn-helix transcription factor / Homeodomain transcription factor / Homeobox protein DLX-5
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.