🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

BAX

DescripciónApoptosis regulator BAX

Gene and Protein Information

Gene ID581
Uniprot Accession IDs Q07812 A8K4W1 P55269 Q07814 Q07815 Q8WZ49 Q9NR76 Q9NYG7 Q9UCZ6 Q9UCZ7 Q9UQD6
Ensembl ID ENSP00000293288
Symbol BCL2L4 BCL2L4
FamilyBelongs to the Bcl-2 family.
Sequence
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp747093BAXBCL2 associated X, apoptosis regulator9598VGNC:10275OMA, EggNOG
Macaque718948BAXBCL2 associated X, apoptosis regulator9544Inparanoid, OMA, EggNOG
Mouse12028BaxBCL2-associated X protein10090MGI:99702Inparanoid, OMA, EggNOG
Rat24887BaxBCL2 associated X, apoptosis regulator10116RGD:2192Inparanoid, OMA, EggNOG
Dog403523BAXBCL2 associated X, apoptosis regulator9615VGNC:38388Inparanoid, OMA, EggNOG
Horse100054674BAXBCL2 associated X, apoptosis regulator9796VGNC:50999Inparanoid, OMA, EggNOG
Cow280730BAXBCL2 associated X, apoptosis regulator9913VGNC:26428Inparanoid, OMA, EggNOG
Pig396633BAXBCL2 associated X, apoptosis regulator9823Inparanoid, OMA, EggNOG
Opossum100030412BAXBCL2 associated X, apoptosis regulator13616Inparanoid, OMA, EggNOG
Anole lizard100561911LOC100561911apoptosis regulator BAX28377OMA, EggNOG
Xenopus394793baxBCL2-associated X protein8364XB-GENE-486067Inparanoid, OMA, EggNOG
Zebrafish58081baxaBCL2 associated X, apoptosis regulator a7955ZDB-GENE-000511-6Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.