224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Myc box-dependent-interacting protein 1 |
|---|
Gene and Protein Information
| Gene ID | 274 |
|---|---|
| Uniprot Accession IDs | O00499 O00297 O00545 O43867 O60552 O60553 O60554 O60555 O75514 O75515 O75516 O75517 O75518 Q659B7 Q92944 Q99688 |
| Ensembl ID | ENSP00000316779 |
| Symbol | AMPHL CNM2 AMPH2 AMPHL SH3P9 |
| Sequence | MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 713587 | BIN1 | bridging integrator 1 | 9544 | Inparanoid, OMA | |
| Mouse | 30948 | Bin1 | bridging integrator 1 | 10090 | MGI:108092 | Inparanoid, OMA, EggNOG |
| Rat | 117028 | Bin1 | bridging integrator 1 | 10116 | RGD:621786 | Inparanoid, OMA, EggNOG |
| Dog | 483870 | BIN1 | bridging integrator 1 | 9615 | VGNC:38458 | Inparanoid, OMA |
| Horse | 100052213 | BIN1 | bridging integrator 1 | 9796 | VGNC:15830 | Inparanoid, OMA, EggNOG |
| Cow | 614576 | BIN1 | bridging integrator 1 | 9913 | VGNC:26497 | Inparanoid, OMA, EggNOG |
| Pig | 100037305 | BIN1 | bridging integrator 1 | 9823 | Inparanoid, OMA | |
| Opossum | 100018912 | BIN1 | bridging integrator 1 | 13616 | Inparanoid, OMA | |
| Chicken | 424228 | BIN1 | bridging integrator 1 | 9031 | CGNC:52157 | Inparanoid, OMA |
| Anole lizard | 100557585 | bin1 | bridging integrator 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 394839 | bin1 | bridging integrator 1 | 8364 | XB-GENE-979735 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.