🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

COX4I2

DescripciónCytochrome c oxidase subunit 4 isoform 2, mitochondrial

Gene and Protein Information

Gene ID84701
Uniprot Accession IDs Q96KJ9 Q6GTF4 Q9H0Z4
Ensembl ID ENSP00000365243
Symbol COX4L2 COX4 COX4B COX4-2 COX4L2 COXIV-2 dJ857M17.2
FamilyBelongs to the cytochrome c oxidase IV family.
Sequence
MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp469913COX4I2cytochrome c oxidase subunit 4I29598VGNC:9832OMA, EggNOG
Macaque713095COX4I2cytochrome c oxidase subunit IV isoform 2 (lung)9544Inparanoid, OMA, EggNOG
Mouse84682Cox4i2cytochrome c oxidase subunit 4I210090MGI:2135755Inparanoid, OMA, EggNOG
Rat84683Cox4i2cytochrome c oxidase subunit 4i210116RGD:69422Inparanoid, OMA, EggNOG
Dog485825COX4I2cytochrome c oxidase subunit 4I29615VGNC:54289Inparanoid, OMA, EggNOG
Horse100053548COX4I2cytochrome c oxidase subunit 4I29796VGNC:16802Inparanoid, OMA, EggNOG
Cow618339COX4I2cytochrome c oxidase subunit 4I29913VGNC:27635Inparanoid, OMA, EggNOG
Anole lizardCOX4I2cytochrome c oxidase subunit 4I2 [Source:HGNC Symbol;Acc:HGNC:16232]28377Inparanoid, OMA, EggNOG
Zebrafish393776cox4i2cytochrome c oxidase subunit IV isoform 27955ZDB-GENE-040426-1775OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.