224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Egl nine homolog 3 |
|---|
Gene and Protein Information
| Gene ID | 112399 |
|---|---|
| Uniprot Accession IDs | Q9H6Z9 Q2TA79 Q3B8N4 Q6P1R2 |
| Ensembl ID | ENSP00000250457 |
| Symbol | PHD3 HIFPH3 HIFP4H3 |
| Sequence | MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452850 | EGLN3 | egl-9 family hypoxia inducible factor 3 | 9598 | VGNC:10306 | OMA, EggNOG |
| Macaque | 717342 | EGLN3 | egl-9 family hypoxia inducible factor 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 112407 | Egln3 | egl-9 family hypoxia-inducible factor 3 | 10090 | MGI:1932288 | Inparanoid, OMA, EggNOG |
| Rat | 54702 | Egln3 | egl-9 family hypoxia-inducible factor 3 | 10116 | RGD:71019 | Inparanoid, OMA, EggNOG |
| Dog | 480286 | EGLN3 | egl-9 family hypoxia inducible factor 3 | 9615 | VGNC:40241 | Inparanoid, OMA, EggNOG |
| Horse | 100056635 | EGLN3 | egl-9 family hypoxia inducible factor 3 | 9796 | VGNC:17461 | Inparanoid, OMA, EggNOG |
| Cow | 535578 | EGLN3 | egl-9 family hypoxia inducible factor 3 | 9913 | VGNC:28367 | Inparanoid, OMA, EggNOG |
| Pig | 100152368 | EGLN3 | egl-9 family hypoxia inducible factor 3 | 9823 | OMA, EggNOG | |
| Opossum | 100013679 | EGLN3 | egl-9 family hypoxia inducible factor 3 | 13616 | Inparanoid, EggNOG | |
| Platypus | 100081498 | EGLN3 | egl-9 family hypoxia inducible factor 3 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 423316 | EGLN3 | egl-9 family hypoxia inducible factor 3 | 9031 | CGNC:7601 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555054 | egln3 | egl-9 family hypoxia inducible factor 3 | 28377 | OMA, EggNOG | |
| Xenopus | 100145602 | egln3 | egl-9 family hypoxia-inducible factor 3 | 8364 | XB-GENE-964334 | Inparanoid, OMA, EggNOG |
| Zebrafish | 406602 | egln3 | egl-9 family hypoxia-inducible factor 3 | 7955 | ZDB-GENE-040426-2541 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.