🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

COIL

DescripciónCoilin

Gene and Protein Information

Gene ID8161
Uniprot Accession IDs P38432 B2R931
Ensembl ID ENSP00000240316
Symbol CLN80 CLN80 p80-coilin
FamilyBelongs to the coilin family.
Sequence
MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp455147COILcoilin9598VGNC:9416OMA, EggNOG
Macaque708103COILcoilin9544Inparanoid, OMA, EggNOG
Mouse12812Coilcoilin10090MGI:104842Inparanoid, OMA, EggNOG
Rat50998Coilcoilin10116RGD:62031Inparanoid, OMA, EggNOG
Dog480564COILcoilin9615VGNC:39454Inparanoid, OMA, EggNOG
Horse100070720COILcoilin9796VGNC:16719Inparanoid, OMA, EggNOG
Cow507580COILcoilin9913VGNC:27552Inparanoid, OMA, EggNOG
Pig100525713COILcoilin9823OMA, EggNOG
Opossum100013845COILcoilin13616Inparanoid, OMA, EggNOG
Chicken417402COILcoilin9031CGNC:2290Inparanoid, OMA
Anole lizard103279413coilcoilin28377Inparanoid, OMA, EggNOG
Zebrafish58024coilcoilin p807955ZDB-GENE-000330-8Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    Coilin
DTO Classes
protein    /    Nucleic acid binding    /    DNA binding protein    /    Coilin

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.