🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CLPP

DescripciónATP-dependent Clp protease proteolytic subunit, mitochondrial

Gene and Protein Information

Gene ID8192
Uniprot Accession IDs Q16740 B2R4W5
Ensembl ID ENSP00000245816
Symbol DFNB81 PRLTS3
FamilyBelongs to the peptidase S14 family.
Sequence
MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp455637CLPPcaseinolytic mitochondrial matrix peptidase proteolytic subunit9598VGNC:2385OMA, EggNOG
Macaque699593CLPPcaseinolytic mitochondrial matrix peptidase proteolytic subunit9544OMA, EggNOG
Mouse53895Clppcaseinolytic mitochondrial matrix peptidase proteolytic subunit10090MGI:1858213Inparanoid, OMA, EggNOG
Rat301117Clppcaseinolytic mitochondrial matrix peptidase proteolytic subunit10116RGD:1588583Inparanoid, OMA, EggNOG
Dog611738CLPPcaseinolytic mitochondrial matrix peptidase proteolytic subunit9615VGNC:39356Inparanoid, OMA, EggNOG
Horse100065472CLPPcaseinolytic mitochondrial matrix peptidase proteolytic subunit9796VGNC:16630Inparanoid, OMA, EggNOG
Cow535981CLPPcaseinolytic mitochondrial matrix peptidase proteolytic subunit9913VGNC:27459Inparanoid, OMA, EggNOG
Anole lizard100558657clppcaseinolytic mitochondrial matrix peptidase proteolytic subunit28377Inparanoid, OMA, EggNOG
Xenopus100135748clppcaseinolytic mitochondrial matrix peptidase proteolytic subunit8364XB-GENE-969408Inparanoid, OMA, EggNOG
Zebrafish553713clppcaseinolytic mitochondrial matrix peptidase proteolytic subunit7955ZDB-GENE-030131-7860Inparanoid, OMA, EggNOG
C. elegans174594clpp-1ATP-dependent Clp protease proteolytic subunit 1, mitochondrial6239Inparanoid, OMA, EggNOG
Fruitfly34402CG5045CG5045 gene product from transcript CG5045-RB7227FBgn0032229Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.