224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Calcium-binding mitochondrial carrier protein Aralar1 |
|---|
Gene and Protein Information
| Gene ID | 8604 |
|---|---|
| Uniprot Accession IDs | O75746 B3KR64 Q96AM8 |
| Ensembl ID | ENSP00000388658 |
| Symbol | ARALAR1 AGC1 ARALAR EIEE39 |
| Family | Belongs to the mitochondrial carrier (TC 2.A.29) family. |
| Sequence | MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMVTIRSHMLTPFVEENLVSAAGGSISHQVSFSYFNAFNSLLNNMELVRKIYSTLAGTRKDVEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGALPYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGSGSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTRRDGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGLYKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGHVGGLNLLAAGAMAGVPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKFKSPSVAVVQPKAAVAATQ Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 459736 | SLC25A12 | solute carrier family 25 member 12 | 9598 | VGNC:9057 | OMA, EggNOG |
| Macaque | 695173 | SLC25A12 | solute carrier family 25 member 12 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 78830 | Slc25a12 | solute carrier family 25 (mitochondrial carrier, Aralar), member 12 | 10090 | MGI:1926080 | Inparanoid, OMA, EggNOG |
| Dog | 478798 | SLC25A12 | solute carrier family 25 member 12 | 9615 | VGNC:46292 | Inparanoid, OMA |
| Horse | 100063768 | SLC25A12 | solute carrier family 25 member 12 | 9796 | VGNC:23091 | Inparanoid, OMA |
| Cow | 539494 | SLC25A12 | solute carrier family 25 member 12 | 9913 | VGNC:34743 | Inparanoid, OMA, EggNOG |
| Opossum | 100025011 | SLC25A12 | solute carrier family 25 member 12 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | SLC25A12 | solute carrier family 25 member 12 [Source:HGNC Symbol;Acc:HGNC:10982] | 9258 | OMA, EggNOG | ||
| Chicken | 431387 | SLC25A12 | solute carrier family 25 member 12 | 9031 | CGNC:7264 | Inparanoid, OMA |
| Anole lizard | 100556466 | slc25a12 | solute carrier family 25 member 12 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549674 | slc25a12 | solute carrier family 25 member 12 | 8364 | XB-GENE-1002100 | Inparanoid, OMA, EggNOG |
| Zebrafish | 337675 | slc25a12 | solute carrier family 25 (aspartate/glutamate carrier), member 12 | 7955 | ZDB-GENE-031006-11 | Inparanoid, OMA |
| Fruitfly | 43616 | aralar1 | CG2139 gene product from transcript CG2139-RC | 7227 | FBgn0028646 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial amino acid transporter subfamily / Calcium-binding mitochondrial carrier protein Aralar1
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial amino acid transporter subfamily / Calcium-binding mitochondrial carrier protein Aralar1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.