ATP4B

DescripciónPotassium-transporting ATPase subunit beta

Gene and Protein Information

Gene ID496
Uniprot Accession IDs P51164 B1B0N8
Ensembl ID ENSP00000334216
Symbol ATP6B
FamilyBelongs to the X(+)/potassium ATPases subunit beta family.
Sequence
MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp738405ATP4BATPase H+/K+ transporting subunit beta9598VGNC:7827OMA, EggNOG
Mouse11945Atp4bATPase, H+/K+ exchanging, beta polypeptide10090MGI:88114Inparanoid, OMA, EggNOG
Rat24217Atp4bATPase H+/K+ transporting subunit beta10116RGD:2178Inparanoid, OMA, EggNOG
Dog404020ATP4BATPase H+/K+ transporting subunit beta9615VGNC:38263Inparanoid, OMA, EggNOG
Horse100069135ATP4BATPase H+/K+ transporting subunit beta9796VGNC:15658Inparanoid, OMA, EggNOG
Cow614308ATP4BATPase H+/K+ transporting subunit beta9913VGNC:26298Inparanoid, OMA, EggNOG
Pig397131ATP4BATPase H+/K+ transporting beta subunit9823Inparanoid, OMA, EggNOG
OpossumATP4BATPase H+/K+ transporting beta subunit [Source:HGNC Symbol;Acc:HGNC:820]13616Inparanoid, OMA, EggNOG
Chicken386581ATP4BATPase H+/K+ transporting beta subunit9031CGNC:12620Inparanoid, OMA
Xenopus448282atp4bATPase, H+/K+ exchanging, beta polypeptide8364XB-GENE-944891Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transporter    /    cation transporter    /    Potassium-transporting ATPase subunit beta
DTO Classes
protein    /    Transporter    /    P-type ATPases    /    H+/K+-ATPases    /    Potassium-transporting ATPase subunit beta

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.