🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CMA1

DescripciónChymase

Gene and Protein Information

Gene ID1215
Uniprot Accession IDs P23946 B5BUM8 Q16018 Q3SY36 Q3SY37 Q9UDH5
Ensembl ID ENSP00000250378
Symbol CYH CYM CYH MCT1 chymase
FamilyBelongs to the peptidase S1 family. Granzyme subfamily.
Sequence
MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp745533CMA1chymase 19598VGNC:8197OMA, EggNOG
Macaque716395CMA1chymase 19544Inparanoid, OMA, EggNOG
Mouse17228Cma1chymase 1, mast cell10090MGI:96941Inparanoid, OMA, EggNOG
Rat25627Cma1chymase 110116RGD:2365Inparanoid, OMA, EggNOG
Dog490628CMA1chymase 19615VGNC:49768Inparanoid, OMA, EggNOG
Cow540321LOC540321mast cell protease 29913Inparanoid, OMA
Cow100139881LOC100139881mast cell protease 29913OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.