The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
COL10A1 Descripción Collagen alpha-1(X) chain
Gene and Protein Information Gene ID 1300 Uniprot Accession IDs Q03692 A1L4P2 Ensembl ID ENSP00000327368 Sequence MLPQIPFLLLVSLNLVHGVFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGLPGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGIATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM
Show more
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Chimp 742603 COL10A1 collagen type X alpha 1 chain 9598 VGNC:10661 OMA, EggNOG Mouse 12813 Col10a1 collagen, type X, alpha 1 10090 MGI:88445 Inparanoid, OMA, EggNOG Rat 25681 Col10a1 collagen type X alpha 1 chain 10116 RGD:2371 Inparanoid, OMA Dog 100856711 COL10A1 collagen type X alpha 1 chain 9615 VGNC:39455 Inparanoid, OMA, EggNOG Horse 100066959 COL10A1 collagen type X alpha 1 chain 9796 VGNC:16720 Inparanoid, OMA, EggNOG Cow 282416 COL10A1 collagen type X alpha 1 chain 9913 VGNC:27553 Inparanoid, OMA, EggNOG Pig 448809 COL10A1 collagen type X alpha 1 chain 9823 Inparanoid, OMA, EggNOG Opossum 103105512 COL10A1 collagen type X alpha 1 chain 13616 Inparanoid, OMA, EggNOG Platypus COL10A1 collagen type X alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2185] 9258 OMA, EggNOG Chicken 100858979 COL10A1 collagen, type X, alpha 1 9031 CGNC:64139 Inparanoid, OMA Anole lizard COL10A1 collagen type X alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2185] 28377 Inparanoid, OMA, EggNOG Xenopus 105947294 col10a1 collagen, type X, alpha 1 8364 XB-GENE-6468756 OMA, EggNOG
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.