The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
BANF1 Descripción Barrier-to-autointegration factor
Gene and Protein Information Gene ID 8815 Uniprot Accession IDs O75531 O60558 Q6FGG7 Ensembl ID ENSP00000310275 Symbol BAF BCRG1 BAF NGPS BCRP1 D14S1460 Family Belongs to the BAF family. Sequence MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Chimp 746065 BANF1 barrier to autointegration factor 1 9598 VGNC:10581 OMA, EggNOG Macaque 715124 BANF1 barrier to autointegration factor 1 9544 Inparanoid, OMA, EggNOG Mouse 23825 Banf1 barrier to autointegration factor 1 10090 MGI:1346330 Inparanoid, OMA, EggNOG Rat 114087 Banf1 barrier to autointegration factor 1 10116 RGD:620662 Inparanoid, OMA, EggNOG Dog 611961 BANF1 barrier to autointegration factor 1 9615 VGNC:51841 Inparanoid, OMA, EggNOG Horse 100052051 BANF1 barrier to autointegration factor 1 9796 Inparanoid, OMA, EggNOG Cow 360196 BANF1 barrier to autointegration factor 1 9913 VGNC:54634 Inparanoid, OMA, EggNOG Pig 100622671 BANF1 barrier to autointegration factor 1 9823 OMA, EggNOG Opossum 100016257 BANF1 barrier to autointegration factor 1 13616 Inparanoid, OMA Xenopus 100380105 banf1 barrier to autointegration factor 1 8364 XB-GENE-5745250 Inparanoid, OMA, EggNOG Zebrafish 334717 banf1 barrier to autointegration factor 1 7955 ZDB-GENE-030131-6657 Inparanoid, OMA, EggNOG C. elegans 176330 baf-1 Barrier-to-autointegration factor 1 6239 Inparanoid, OMA, EggNOG Fruitfly 34095 baf barrier to autointegration factor 7227 FBgn0031977 Inparanoid, EggNOG
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.