🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

AURKC

DescripciónAurora kinase C

Gene and Protein Information

Gene ID6795
Uniprot Accession IDs Q9UQB9 O60681 O75442 Q6AZY8 Q6DLZ0 Q9UPK5
Ensembl ID ENSP00000302898
Symbol AIE2 AIK3 AIRK3 ARK3 STK13 AIE2 AIK3 ARK3 AurC SPGF5 STK13 HEL-S-90 aurora-C
FamilyBelongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.
Sequence
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp740217AURKCaurora kinase C9598VGNC:2099OMA, EggNOG
Macaque709801AURKCaurora kinase C9544Inparanoid, OMA, EggNOG
Mouse20871Aurkcaurora kinase C10090MGI:1321119Inparanoid, OMA
Dog102155400AURKCaurora kinase C9615VGNC:38313Inparanoid, OMA
Horse100051177AURKCaurora kinase C9796VGNC:15705Inparanoid, OMA
Cow618599AURKCaurora kinase C9913Inparanoid, OMA
C. elegans172268air-2Aurora/IPL1-related protein kinase 26239Inparanoid, OMA
S.cerevisiae855892IPL1aurora kinase4932S000006130Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.