🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

B4GALT4

DescripciónBeta-1,4-galactosyltransferase 4

Gene and Protein Information

Gene ID8702
Uniprot Accession IDs O60513 Q68D68 Q9BSW3 Q9C078 Beta-1,4-GalTase 4
Ensembl ID ENSP00000420161
Symbol B4Gal-T4 beta4Gal-T4
FamilyBelongs to the glycosyltransferase 7 family.
Sequence
MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp100608173B4GALT4beta-1,4-galactosyltransferase 49598VGNC:8824OMA, EggNOG
Macaque711983B4GALT4beta-1,4-galactosyltransferase 49544Inparanoid, OMA
Mouse56375B4galt4UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 410090MGI:1928387Inparanoid, OMA, EggNOG
Rat303923B4galt4beta-1,4-galactosyltransferase 410116RGD:1307880Inparanoid, OMA, EggNOG
Dog608143B4GALT4beta-1,4-galactosyltransferase 49615VGNC:38352Inparanoid, OMA, EggNOG
Horse100071082B4GALT4beta-1,4-galactosyltransferase 49796VGNC:15742Inparanoid, OMA, EggNOG
Cow511328B4GALT4beta-1,4-galactosyltransferase 49913VGNC:26391Inparanoid, OMA, EggNOG
Pig397380B4GALT4beta-1,4-galactosyltransferase 49823OMA, EggNOG
Opossum100015888B4GALT4beta-1,4-galactosyltransferase 413616Inparanoid, OMA, EggNOG
Chicken418341B4GALT4beta-1,4-galactosyltransferase 49031CGNC:11208Inparanoid, OMA, EggNOG
Anole lizard100553568b4galt4beta-1,4-galactosyltransferase 428377Inparanoid, OMA, EggNOG
Xenopus100488464b4galt4UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 48364XB-GENE-953813Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    glycosyltransferase    /    Beta-1,4-galactosyltransferase 4
DTO Classes
protein    /    Enzyme    /    Transferase    /    Glycosyltransferase    /    Beta-1,4-galactosyltransferase 4

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.