🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

BATF3

DescripciónBasic leucine zipper transcriptional factor ATF-like 3

Gene and Protein Information

Gene ID55509
Uniprot Accession IDs Q9NR55 B-ATF-3
Ensembl ID ENSP00000243440
Symbol SNFT JDP1 SNFT JUNDM1
FamilyBelongs to the bZIP family.
Sequence
MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp457721BATF3basic leucine zipper ATF-like transcription factor 39598VGNC:11734OMA, EggNOG
Macaque710551BATF3basic leucine zipper ATF-like transcription factor 39544OMA, EggNOG
Mouse381319Batf3basic leucine zipper transcription factor, ATF-like 310090MGI:1925491Inparanoid, OMA, EggNOG
Rat60462Batf3basic leucine zipper ATF-like transcription factor 310116RGD:620501Inparanoid, OMA, EggNOG
Dog490283BATF3basic leucine zipper ATF-like transcription factor 39615VGNC:38387Inparanoid, OMA, EggNOG
Horse100053960BATF3basic leucine zipper ATF-like transcription factor 39796VGNC:15772Inparanoid, OMA, EggNOG
Cow535008BATF3basic leucine zipper ATF-like transcription factor 39913VGNC:26427Inparanoid, OMA, EggNOG
Opossum100016641BATF3basic leucine zipper ATF-like transcription factor 313616Inparanoid, OMA, EggNOG
Anole lizardBATF3basic leucine zipper ATF-like transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:28915]28377Inparanoid, EggNOG
Zebrafish751677batf3basic leucine zipper transcription factor, ATF-like 37955ZDB-GENE-041014-356Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.