🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA Structure
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CDX4

DescripciónHomeobox protein CDX-4

Gene and Protein Information

Gene ID1046
Uniprot Accession IDs O14627 A1A513 Q5JS20
Ensembl ID ENSP00000362613
FamilyBelongs to the Caudal homeobox family.
Sequence
MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp473667CDX4caudal type homeobox 49598VGNC:1401OMA, EggNOG
Macaque701374CDX4caudal type homeobox 49544Inparanoid, OMA, EggNOG
Mouse12592Cdx4caudal type homeobox 410090MGI:88362Inparanoid, OMA, EggNOG
Rat302400Cdx4caudal type homeo box 410116RGD:1561529Inparanoid, OMA, EggNOG
Dog491960CDX4caudal type homeobox 49615VGNC:39086Inparanoid, OMA, EggNOG
Horse100059663CDX4caudal type homeobox 49796VGNC:16378Inparanoid, OMA, EggNOG
Cow519648CDX4caudal type homeobox 49913VGNC:27159OMA, EggNOG
Pig100623433CDX4caudal type homeobox 49823OMA, EggNOG
Chicken395320CDX4caudal type homeobox 49031CGNC:49264Inparanoid, EggNOG
Xenopus395056cdx4caudal type homeobox 48364XB-GENE-482787Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    DNA binding protein    /    Homeobox protein CDX-4
protein    /    nucleic acid binding    /    homeodomain transcription factor    /    Homeobox protein CDX-4
DTO Classes
protein    /    Transcription factor    /    Helix-turn-helix transcription factor    /    Homeodomain transcription factor    /    Homeobox protein CDX-4

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.