🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CDK6

DescripciónCyclin-dependent kinase 6

Gene and Protein Information

Gene ID1021
Uniprot Accession IDs Q00534 A4D1G0
Ensembl ID ENSP00000265734
Symbol CDKN6 MCPH12 PLSTIRE
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp746968CDK6cyclin dependent kinase 69598VGNC:13637OMA, EggNOG
Macaque701822CDK6cyclin dependent kinase 69544Inparanoid, OMA, EggNOG
Mouse12571Cdk6cyclin-dependent kinase 610090MGI:1277162Inparanoid, OMA, EggNOG
Rat114483Cdk6cyclin-dependent kinase 610116RGD:621121Inparanoid, OMA, EggNOG
Dog609920CDK6cyclin dependent kinase 69615VGNC:54756Inparanoid, OMA
Horse100061625CDK6cyclin dependent kinase 69796VGNC:16354Inparanoid, OMA
Cow511754CDK6cyclin dependent kinase 69913VGNC:27133Inparanoid, OMA
Opossum100021675CDK6cyclin dependent kinase 613616Inparanoid, OMA, EggNOG
Chicken420558CDK6cyclin dependent kinase 69031CGNC:51286Inparanoid, OMA, EggNOG
Anole lizard100558412cdk6cyclin dependent kinase 628377Inparanoid, OMA
Xenopuscdk6cyclin-dependent kinase 6 [Source:Xenbase;Acc:XB-GENE-985427]8364OMA, EggNOG
Zebrafish100034507cdk6cyclin-dependent kinase 67955ZDB-GENE-060503-786Inparanoid, OMA
C. elegans181472cdk-4Cyclin-dependent kinase 4 homolog6239OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.