224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Chymotrypsin-like elastase family member 1 |
|---|
Gene and Protein Information
| Gene ID | 1990 |
|---|---|
| Uniprot Accession IDs | Q9UNI1 Q5MLF0 Q6DJT0 Q6ISM6 |
| Ensembl ID | ENSP00000293636 |
| Symbol | ELA1 ELA1 |
| Family | Belongs to the peptidase S1 family. Elastase subfamily. |
| Sequence | MLVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCVDYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNSPCYITGWGKTKTNGQLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIASN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 740437 | CELA1 | chymotrypsin like elastase family member 1 | 9598 | VGNC:5333 | OMA, EggNOG |
| Macaque | 695507 | CELA1 | chymotrypsin like elastase family member 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 109901 | Cela1 | chymotrypsin-like elastase family, member 1 | 10090 | MGI:95314 | Inparanoid, OMA, EggNOG |
| Rat | 24331 | Cela1 | chymotrypsin-like elastase family, member 1 | 10116 | RGD:2547 | Inparanoid, OMA, EggNOG |
| Dog | 403515 | CELA1 | chymotrypsin like elastase family member 1 | 9615 | VGNC:39092 | Inparanoid, OMA, EggNOG |
| Horse | 100052672 | CELA1 | chymotrypsin like elastase family member 1 | 9796 | VGNC:16385 | Inparanoid, OMA, EggNOG |
| Cow | 281139 | CELA1 | chymotrypsin like elastase family member 1 | 9913 | VGNC:27166 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100567701 | cela1 | chymotrypsin like elastase family member 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 445282 | zgc:92041 | zgc:92041 | 7955 | ZDB-GENE-040808-55 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.