Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | V-type proton ATPase subunit d 1 |
|---|
Gene and Protein Information
| Gene ID | 9114 |
|---|---|
| Uniprot Accession IDs | P61421 P12953 Q02547 V-ATPase subunit d 1 |
| Ensembl ID | ENSP00000290949 |
| Symbol | ATP6D VPATPD P39 VATX VMA6 ATP6D ATP6DV VPATPD |
| Family | Belongs to the V-ATPase V0D/AC39 subunit family. |
| Sequence | MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741872 | ATP6V0D1 | ATPase H+ transporting V0 subunit d1 | 9598 | VGNC:13667 | Inparanoid, OMA, EggNOG |
| Mouse | 11972 | Atp6v0d1 | ATPase, H+ transporting, lysosomal V0 subunit D1 | 10090 | MGI:1201778 | Inparanoid, OMA, EggNOG |
| Rat | 291969 | Atp6v0d1 | ATPase H+ transporting V0 subunit D1 | 10116 | RGD:1306159 | Inparanoid, OMA, EggNOG |
| Dog | 479685 | ATP6V0D1 | ATPase H+ transporting V0 subunit d1 | 9615 | VGNC:38273 | Inparanoid, OMA, EggNOG |
| Horse | 100053316 | ATP6V0D1 | ATPase H+ transporting V0 subunit d1 | 9796 | VGNC:15672 | Inparanoid, OMA, EggNOG |
| Cow | 282148 | ATP6V0D1 | ATPase H+ transporting V0 subunit d1 | 9913 | VGNC:26312 | Inparanoid, OMA, EggNOG |
| Pig | 100525048 | ATP6V0D1 | ATPase H+ transporting V0 subunit d1 | 9823 | OMA, EggNOG | |
| Opossum | 100015943 | ATP6V0D1 | ATPase H+ transporting V0 subunit d1 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100563898 | atp6v0d1 | ATPase H+ transporting V0 subunit d1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 550064 | atp6v0d1 | ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 | 8364 | XB-GENE-989918 | Inparanoid, OMA, EggNOG |
| Zebrafish | 322811 | atp6v0d1 | ATPase H+ transporting V0 subunit d1 | 7955 | ZDB-GENE-030131-1531 | Inparanoid, OMA, EggNOG |
| C. elegans | 172134 | vha-16 | V-type proton ATPase subunit | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 31342 | VhaAC39-1 | Vacuolar H[+] ATPase AC39 subunit 1 | 7227 | FBgn0028665 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 851168 | VMA6 | H(+)-transporting V0 sector ATPase subunit d | 4932 | S000004439 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / cation transporter / ATP synthase / V-type proton ATPase subunit d 1
protein / cation transporter / hydrolase / V-type proton ATPase subunit d 1
protein / cation transporter / ATP synthase / V-type proton ATPase subunit d 1
protein / cation transporter / hydrolase / V-type proton ATPase subunit d 1
DTO Classes
protein / Transporter / F-type and V-type ATPases / V-type ATPase / V-type proton ATPase subunit d 1
protein / Transporter / F-type and V-type ATPases / V-type ATPase / V-type proton ATPase subunit d 1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.