224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Vitamin K epoxide reductase complex subunit 1 |
|---|
Gene and Protein Information
| Gene ID | 79001 |
|---|---|
| Uniprot Accession IDs | Q9BQB6 A6NIQ6 B2R4Z6 Q6UX90 Q7Z2R4 |
| Ensembl ID | ENSP00000378426 |
| Symbol | VKOR VKOR MST134 MST576 VKCFD2 EDTP308 |
| Family | Belongs to the VKOR family. |
| Sequence | MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYLAWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100610370 | VKORC1 | vitamin K epoxide reductase complex subunit 1 | 9598 | VGNC:5952 | OMA, EggNOG |
| Mouse | 27973 | Vkorc1 | vitamin K epoxide reductase complex, subunit 1 | 10090 | MGI:106442 | Inparanoid, OMA |
| Rat | 309004 | Vkorc1 | vitamin K epoxide reductase complex, subunit 1 | 10116 | RGD:1303107 | Inparanoid, OMA |
| Dog | 479775 | VKORC1 | vitamin K epoxide reductase complex subunit 1 | 9615 | VGNC:54091 | Inparanoid, OMA |
| Cow | 445422 | VKORC1 | vitamin K epoxide reductase complex subunit 1 | 9913 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.