224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Proto-oncogene Wnt-1 |
|---|
Gene and Protein Information
| Gene ID | 7471 |
|---|---|
| Uniprot Accession IDs | P04628 Q5U0N2 |
| Ensembl ID | ENSP00000293549 |
| Symbol | INT1 INT1 OI15 BMND16 |
| Family | Belongs to the Wnt family. |
| Sequence | MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 742674 | WNT1 | Wnt family member 1 | 9598 | VGNC:10083 | OMA, EggNOG |
| Macaque | 709009 | WNT1 | Wnt family member 1 | 9544 | Inparanoid, OMA | |
| Mouse | 22408 | Wnt1 | wingless-type MMTV integration site family, member 1 | 10090 | MGI:98953 | Inparanoid, OMA, EggNOG |
| Rat | 24881 | Wnt1 | Wnt family member 1 | 10116 | RGD:1597195 | Inparanoid, OMA |
| Dog | 486560 | WNT1 | Wnt family member 1 | 9615 | VGNC:48419 | Inparanoid, OMA, EggNOG |
| Horse | 100058859 | WNT1 | Wnt family member 1 | 9796 | VGNC:25041 | Inparanoid, OMA, EggNOG |
| Cow | 540662 | WNT1 | Wnt family member 1 | 9913 | VGNC:36953 | Inparanoid, OMA, EggNOG |
| Pig | WNT1 | Wnt family member 1 [Source:HGNC Symbol;Acc:HGNC:12774] | 9823 | Inparanoid, OMA, EggNOG | ||
| Opossum | 100032741 | WNT1 | Wnt family member 1 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100562340 | wnt1 | Wnt family member 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100491444 | wnt1 | Wnt family member 1 | 8364 | XB-GENE-485280 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30128 | wnt1 | wingless-type MMTV integration site family, member 1 | 7955 | ZDB-GENE-980526-526 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.