224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Ubiquitin-conjugating enzyme E2 E3 |
|---|
Gene and Protein Information
| Gene ID | 10477 |
|---|---|
| Uniprot Accession IDs | Q969T4 B2RAD6 D3DPG3 Q5U0R7 Q7Z4W4 |
| Ensembl ID | ENSP00000386788 |
| Symbol | UBCE4 UBCH9 UBCH9 UbcM2 |
| Family | Belongs to the ubiquitin-conjugating enzyme family. |
| Sequence | MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 704530 | UBE2E3 | ubiquitin conjugating enzyme E2 E3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 22193 | Ube2e3 | ubiquitin-conjugating enzyme E2E 3 | 10090 | MGI:107412 | Inparanoid, OMA, EggNOG |
| Rat | 295686 | Ube2e3 | ubiquitin-conjugating enzyme E2E 3 | 10116 | RGD:1308894 | Inparanoid, OMA, EggNOG |
| Dog | 612823 | UBE2E3 | ubiquitin conjugating enzyme E2 E3 | 9615 | VGNC:53110 | Inparanoid, OMA |
| Horse | 100067766 | UBE2E3 | ubiquitin conjugating enzyme E2 E3 | 9796 | VGNC:49291 | Inparanoid, OMA, EggNOG |
| Cow | 534349 | UBE2E3 | ubiquitin conjugating enzyme E2 E3 | 9913 | Inparanoid, OMA, EggNOG | |
| Opossum | 100019977 | UBE2E3 | ubiquitin conjugating enzyme E2 E3 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 424122 | UBE2E3 | ubiquitin conjugating enzyme E2 E3 | 9031 | CGNC:14325 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552613 | ube2e3 | ubiquitin conjugating enzyme E2 E3 | 28377 | Inparanoid, OMA | |
| Xenopus | 394925 | ube2e3 | ubiquitin conjugating enzyme E2 E3 | 8364 | XB-GENE-980957 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321689 | ube2e3 | ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast) | 7955 | ZDB-GENE-030131-408 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.