🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

WDFY2

DescripciónWD repeat and FYVE domain-containing protein 2

Gene and Protein Information

Gene ID115825
Uniprot Accession IDs Q96P53 B1AL86 Q96CS1
Ensembl ID ENSP00000298125
Symbol WDF2 ZFYVE22 PROF WDF2 ZFYVE22
Sequence
MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp452730WDFY2WD repeat and FYVE domain containing 29598VGNC:13157OMA, EggNOG
Macaque708929WDFY2WD repeat and FYVE domain containing 29544Inparanoid, OMA, EggNOG
Mouse268752Wdfy2WD repeat and FYVE domain containing 210090MGI:2442811Inparanoid, OMA, EggNOG
Rat305956Wdfy2WD repeat and FYVE domain containing 210116RGD:1307337Inparanoid, OMA
Dog606922WDFY2WD repeat and FYVE domain containing 29615VGNC:54388Inparanoid, OMA, EggNOG
Horse100049955WDFY2WD repeat and FYVE domain containing 29796VGNC:24977Inparanoid, OMA, EggNOG
Opossum100021958WDFY2WD repeat and FYVE domain containing 213616Inparanoid, OMA, EggNOG
PlatypusWDFY2WD repeat and FYVE domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20482]9258OMA, EggNOG
Chicken770107WDFY2WD repeat and FYVE domain containing 29031CGNC:12780Inparanoid, OMA
Anole lizard100565092wdfy2WD repeat and FYVE domain containing 228377Inparanoid, OMA
Xenopus100496386wdfy2WD repeat and FYVE domain containing 28364XB-GENE-961327Inparanoid, OMA
Zebrafish492636wdfy2WD repeat and FYVE domain containing 27955ZDB-GENE-041111-211Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.