🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

WFDC2

DescripciónWAP four-disulfide core domain protein 2

Gene and Protein Information

Gene ID10406
Uniprot Accession IDs Q14508 A2A2A5 A2A2A6 A6PVD5 Q6IB27 Q8WXV9 Q8WXW0 Q8WXW1 Q8WXW2 Q96KJ1
Ensembl ID ENSP00000361761
Symbol HE4 WAP5 HE4 WAP5 EDDM4 dJ461P17.6
Sequence
MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp458283WFDC2WAP four-disulfide core domain 29598VGNC:10138OMA, EggNOG
Macaque710469WFDC2WAP four-disulfide core domain 29544Inparanoid, OMA, EggNOG
Mouse67701Wfdc2WAP four-disulfide core domain 210090MGI:1914951Inparanoid, OMA, EggNOG
Rat286888Wfdc2WAP four-disulfide core domain 210116RGD:628757Inparanoid, OMA, EggNOG
Dog403919WFDC2WAP four-disulfide core domain 29615VGNC:54267Inparanoid, OMA, EggNOG
Horse100056252WFDC2WAP four-disulfide core domain 29796VGNC:25027Inparanoid, OMA, EggNOG
Cow618044WFDC2WAP four-disulfide core domain 29913VGNC:36933Inparanoid, OMA, EggNOG
Opossum100030064WFDC2WAP four-disulfide core domain 213616Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    serine protease inhibitor    /    WAP four-disulfide core domain protein 2
DTO Classes
protein    /    Enzyme modulator    /    Protease inhibitor    /    Serine protease inhibitor    /    WAP four-disulfide core domain protein 2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.